P57738 TCTA_HUMAN

Gene name: TCTA
Protein name: T-cell leukemia translocation-altered gene protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15552 FFAR2 0.99992 cell differentiation GO:0030154
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
2 Q96BZ9 TBC1D20 0.98874 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
3 Q8N1Y9 n/a 0.97582
4 Q6ZRV3 LINC00696 0.9469
5 Q8IY22 CMIP 0.9445 anatomical structure development GO:0048856
embryo development GO:0009790
6 Q5T319 FAM182B 0.94422
7 Q8IUH3 RBM45 0.88815 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q14240 EIF4A2 0.86501 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
9 Q96EZ4 MYEOV 0.85914
10 P36406 TRIM23 0.84837 biological process involved in symbiotic interaction GO:0044403
cellular protein modification process GO:0006464
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKT
STMI:                            MMMMMMMMMMMMMMMMMM              MMMMMMMMMMMMMMMMMMMMM                                       
DO_DISOPRED3:            DDD....DD........................................................................D....DDD....DDDDDDD
DO_IUPRED2A:             ......................................................................DDDDDD.DDDDDDDDDDDDDD......D..
DO_SPOTD:                DD......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD......                  ..............                     ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........                  ..............                     .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                                                         GGqnGstpdG                 
RICH_MOBI_[G]:                                                                                  GlGGqnGstpdG                 

                                          
AA:                      HRE
STMI:                       
DO_DISOPRED3:            DDD
DO_IUPRED2A:             DDD
DO_SPOTD:                DDD
CONSENSUS:               DDD
CONSENSUS_MOBI:          DDD