P57771 RGS8_HUMAN
Gene name: RGS8
Protein name: Regulator of G-protein signaling 8
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NY30 | BTG4 | 0.70711 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 2 | Q86TG1 | TMEM150A | 0.69378 | catabolic process GO:0009056 |
| 3 | Q9NTU7 | CBLN4 | 0.67814 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 4 | Q8IYF3 | TEX11 | 0.65288 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 5 | A6NFQ7 | DPRX | 0.62963 | |
| 6 | A6BM72 | MEGF11 | 0.62116 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 |
| 7 | P60410 | KRTAP10-8 | 0.57735 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 8 | Q9NSB2 | KRT84 | 0.52312 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 9 | P51685 | CCR8 | 0.51777 | cell adhesion GO:0007155 homeostatic process GO:0042592 immune system process GO:0002376 ... |
| 10 | Q5T0L3 | SPATA46 | 0.51008 | cell differentiation GO:0030154 membrane organization GO:0061024 reproduction GO:0000003 |
20 40 60 80 100 AA: MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAK STMI: DO_DISOPRED3: DDDDDD.DDDD......DDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... DO_IUPRED2A: ............................................D....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS: DDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[CS]: ClShkSdSCS
120 140 160 AA: LVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS STMI: DO_DISOPRED3: ...........................................................................DDDDD DO_IUPRED2A: ...........................D.................................................... DO_SPOTD: ..........................................................................DDDDDD CONSENSUS: ...........................................................................DDDDD CONSENSUS_MOBI: ............................................................................DDDD