P59090 TSAS2_HUMAN
Gene name: TSPEAR-AS2
Protein name: Putative uncharacterized protein TSPEAR-AS2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UDW3 | ZMAT5 | 0.71522 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | A6NEH8 | ZNF503-AS2 | 0.57142 | |
| 3 | Q9UIG4 | PSORS1C2 | 0.56667 | |
| 4 | Q9Y4H4 | GPSM3 | 0.565 | immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q6BEB4 | SP5 | 0.55888 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q3C1V1 | C11orf91 | 0.51942 | |
| 7 | Q86XT4 | TRIM50 | 0.51782 | cellular protein modification process GO:0006464 |
| 8 | Q6UXC1 | MAMDC4 | 0.51527 | protein transport GO:0015031 transport GO:0006810 |
| 9 | O00522 | KRIT1 | 0.49709 | |
| 10 | Q9BSE2 | TMEM79 | 0.47985 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
20 40 60 AA: MGNPRLPRLLCALKFSGFLSNIRGPLAGEDGMGDTQLARVRDSALKTPWRPAPCPPPAHSLDDWK STMI: DO_DISOPRED3: DDD.............................................................. DO_IUPRED2A: .........................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D DO_SPOTD: DD.................................................DDDDD.D....... CONSENSUS: DD.................................................DDDDDDD....... CONSENSUS_MOBI: ...........................................DDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[PW]: PWrPaPcPPPahslddW RICH_MOBI_[P]: PwrPaPcPPP RICH_MOBI_[W]: WrpapcpppahslddW RICH_fLPS_MOBI_[P]: PwrPaPcPPP