Q9UDW3 ZMAT5_HUMAN
Gene name: ZMAT5
Protein name: Zinc finger matrin-type protein 5
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P59090 | TSPEAR-AS2 | 0.71522 | |
| 2 | Q9UQ52 | CNTN6 | 0.6247 | |
| 3 | Q6BEB4 | SP5 | 0.60188 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q5HYR2 | DMRTC1; | 0.57832 | |
| 5 | Q969S8 | HDAC10 | 0.56401 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q9UBP9 | GULP1 | 0.55924 | cell death GO:0008219 membrane organization GO:0061024 transport GO:0006810 ... |
| 7 | Q8N431 | RASGEF1C | 0.55874 | signal transduction GO:0007165 |
| 8 | Q9UHM6 | OPN4 | 0.55757 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 nervous system process GO:0050877 ... |
| 9 | Q9Y4H4 | GPSM3 | 0.5548 | immune system process GO:0002376 response to stress GO:0006950 |
| 10 | Q8IWV2 | CNTN4 | 0.5528 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLL STMI: DO_DISOPRED3: D.............................................................................................D..... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .D.................................................................................................. CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: DAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG STMI: DO_DISOPRED3: .....................DDDDDDDDDDDD..................................... DO_IUPRED2A: ....................D..DDD.....................DDDDDDDDDDDDDDDDDDDD... DO_SPOTD: .....................DDDDDDDDDDDDDDD.................................. CONSENSUS: .....................DDDDDDDDDDDD..................................... CONSENSUS_MOBI: .................................................DDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[PW]: PPslraPPPggWPlqPrvqW RICH_MOBI_[P]: PPslraPPPggwPlqP