List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	O95347	SMC2	0.99976	cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ...
2	Q14CX7	NAA25	0.99912	cellular protein modification process GO:0006464 protein maturation GO:0051604
3	Q00059	TFAM	0.99912	biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ...
4	Q13609	DNASE1L3	0.99669	anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ...
5	Q8WW27	APOBEC4	0.99669	cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397
6	O14807	MRAS	0.99164	anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165
7	Q9NYL4	FKBP11	0.98837
8	Q14588	ZNF234	0.98837	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
9	Q9HAW9	UGT1A8	0.97055	carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281
10	P62979	RPS27A	0.97055	biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ...

                                           20                  40                  60                  80                 
AA:                      MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
STMI:                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDD...................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDD.D..................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          ...................................................................................
RICH_[K]:                    KsKrKpppKKK                                                                    
RICH_fLPS_[K]:           mgrrKsKrKpppKKK