P62979 RS27A_HUMAN
Gene name: RPS27A
Protein name: Ubiquitin-40S ribosomal protein S27a
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- membrane organization GO:0061024
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62979 | RPS27A | 1 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q8NEL0 | CCDC54 | 0.99924 | |
| 3 | P49917 | LIG4 | 0.99723 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 4 | Q9NYL4 | FKBP11 | 0.99589 | |
| 5 | Q8N2Z9 | CENPS | 0.99589 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 6 | Q8N9C0 | IGSF22 | 0.99589 | |
| 7 | O14807 | MRAS | 0.99352 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 8 | P21246 | PTN | 0.99259 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 9 | Q13609 | DNASE1L3 | 0.98691 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q8WW27 | APOBEC4 | 0.98691 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
20 40 60 80 100 AA: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ...........................DDDDDDD..............................................DDDDDDDDDDDD........ DO_SPOTD: ............................................................................DDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS: ................................................................................DDDDDDDDDDDD........ CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KKKsyttpKKnK RICH_fLPS_[K]: KKKsyttpKK
120 140 AA: AVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK STMI: DO_DISOPRED3: .....................................................DDD DO_IUPRED2A: ........................................................ DO_SPOTD: .....................................................DDD CONSENSUS: .....................................................DDD CONSENSUS_MOBI: ....................................................DDDD