Q00059 TFAM_HUMAN
Gene name: TFAM
Protein name: Transcription factor A, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8WW27 | APOBEC4 | 0.99923 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | Q13609 | DNASE1L3 | 0.99923 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 3 | P60002 | ELOF1 | 0.99912 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 4 | O95347 | SMC2 | 0.99795 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 5 | O14807 | MRAS | 0.99618 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 6 | Q9NYL4 | FKBP11 | 0.99388 | |
| 7 | Q9BZA0 | TTTY10 | 0.99388 | |
| 8 | Q14588 | ZNF234 | 0.99388 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q8N2Z9 | CENPS | 0.99388 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 10 | Q9HAW9 | UGT1A8 | 0.9798 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQ STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDD....................DDDDD.......................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDD.DD......................................................................................... CONSENSUS: .......................................................... CONSENSUS_MOBI: ..........................................................
120 140 160 180 200 AA: DAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELY STMI: DO_DISOPRED3: ..................................DDDDDDDDDDDDD..................................................... DO_IUPRED2A: .......................................D....D..DDDD.DD.....................DDDDDDDDDDDDD...........D DO_SPOTD: ..............................DDDDDDDDDDDDDDDDDDDDDDD............................................... CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDD............................................... CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KhlKrKamtKKK RICH_fLPS_[K]: dKhlKrKamtKKKel
220 240 AA: IQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC STMI: DO_DISOPRED3: ................................DDDDDDDDDDDDDD DO_IUPRED2A: ..DDDDD...DDDDDDD............................. DO_SPOTD: ........................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................................DDDDDDDDDDDDDD CONSENSUS_MOBI: .....................................DDDDDDDDD