P60763 RAC3_HUMAN
Gene name: RAC3
Protein name: Ras-related C3 botulinum toxin substrate 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P0V8 | SLAMF8 | 0.70711 | anatomical structure development GO:0048856 cell differentiation GO:0030154 homeostatic process GO:0042592 ... |
| 2 | P35236 | PTPN7 | 0.54218 | cellular protein modification process GO:0006464 |
| 3 | P26885 | FKBP2 | 0.5 | |
| 4 | Q9C040 | TRIM2 | 0.42295 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 5 | Q06187 | BTK | 0.38087 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 6 | P51398 | DAP3 | 0.37477 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P18124 | RPL7 | 0.33908 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q96BD8 | SKA1 | 0.339 | cell cycle GO:0007049 cell division GO:0051301 chromosome segregation GO:0007059 ... |
| 9 | Q86VH5 | LRRTM3 | 0.33127 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 10 | Q5HYK9 | ZNF667 | 0.31455 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF STMI: DO_DISOPRED3: ...............................................................................DDDDD.DDDD..D DO_IUPRED2A: ............................................................................................ DO_SPOTD: .................................................................................DDDDDDD.... CONSENSUS: .................................................................................DDDDDDD.... CONSENSUS_MOBI: ..............................................................................DDDDDDDDDDDDDD RICH_MOBI_[KP]: PPPvKKPgKK RICH_MOBI_[KV]: VKKpgKKctV