A0A1B0GUT2 CJ143_HUMAN

Gene name: C10orf143
Protein name: Uncharacterized protein C10orf143

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ICB0 DESI1 0.68719 catabolic process GO:0009056
cellular protein modification process GO:0006464
nucleocytoplasmic transport GO:0006913
...
2 P17066 HSPA6 0.64781 immune system process GO:0002376
protein folding GO:0006457
response to stress GO:0006950
...
3 Q9HCJ5 ZSWIM6 0.53161 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
4 Q05823 RNASEL 0.51276 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q96KF2 PRAC1 0.50731
6 Q9UL25 RAB21 0.50399 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
7 Q9H0H9 CYP4F30P 0.48894
8 Q9NTK5 OLA1 0.48728 transport GO:0006810
vesicle-mediated transport GO:0016192
9 P57738 TCTA 0.48588 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 O15552 FFAR2 0.48541 cell differentiation GO:0030154
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...

                                           20                  40                  60                  80                 100
AA:                      MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDD...DDD.............
DO_IUPRED2A:             ....DD.D.DDDDDDD...........D...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D..DD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD...........D...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
CONSENSUS_MOBI:          .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                                                      GqGrlstGisqnGG                
RICH_MOBI_[G]:                                                                                 GqGrlstGisqnGG                
RICH_MOBI_[CG]:                                                                                       GisqnGGrssaqpCprCiaG   
RICH_MOBI_[CH]:                                                                                                    CprCiagesg
RICH_MOBI_[CI]:                                                                                        IsqnggrssaqpCprCI     
RICH_MOBI_[GI]:                                                                                       GIsqnGGrssaqpcprcIaG   

                                     
AA:                      HFSHTKNH
STMI:                            
DO_DISOPRED3:            DDDDDDDD
DO_IUPRED2A:             .DD.DDDD
DO_SPOTD:                DDDDDDDD
CONSENSUS:               DDDDDDDD
CONSENSUS_MOBI:          DDDDDDDD
RICH_MOBI_[CH]:          HfsH