Q9Y291 RT33_HUMAN

Gene name: MRPS33
Protein name: 28S ribosomal protein S33, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P24844 MYL9 0.9574 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q9NRQ5 SMCO4 0.95298
3 Q9Y324 FCF1 0.95131 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 A0A1B0GTY4 TEX50 0.93676
5 Q92963 RIT1 0.93254 signal transduction GO:0007165
6 A6NIV6 LRRIQ4 0.92424
7 P42127 ASIP 0.92167 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
8 Q6NW29 RWDD4 0.9199
9 O95995 GAS8 0.89874 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
10 P61247 RPS3A 0.89571 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGK
STMI:                                                                                                                        
DO_DISOPRED3:            DDD............................................................................................DDDDD
DO_IUPRED2A:             ...................D.D...........................................................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD.....................................................................................DDDDDDDDDDDD
CONSENSUS:               DDD.....................................................................................DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDD.......................................................................................DDDDDDDDD
RICH_[K]:                                                                                                          KeKpKKgegK
RICH_[GK]:                                                                                                        GKeKpKKGeG 
RICH_fLPS_[K]:                                                                                                     KeKpKKgegK
RICH_MOBI_[K]:                                                                                                       KpKKgegK
RICH_fLPS_MOBI_[K]:                                                                                                 eKpKKgegK

                                       
AA:                      RAAKRK
STMI:                          
DO_DISOPRED3:            DDDDDD
DO_IUPRED2A:             DDDDDD
DO_SPOTD:                DDDDDD
CONSENSUS:               DDDDDD
CONSENSUS_MOBI:          DDDDDD
RICH_[K]:                raaKrK
RICH_fLPS_[K]:           raaKrK
RICH_MOBI_[K]:           raaKrK
RICH_fLPS_MOBI_[K]:      raaKrK