P61313 RL15_HUMAN
Gene name: RPL15
Protein name: 60S ribosomal protein L15
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6PVI3 | NCBP2L | 0.8226 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | P62633 | CNBP | 0.81438 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q9H223 | EHD4 | 0.79264 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 4 | Q8TBK2 | SETD6 | 0.76161 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P14373 | TRIM27 | 0.70111 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 6 | Q96QS1 | TSPAN32 | 0.68537 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
| 7 | Q8NEG7 | DENND6B | 0.67175 | |
| 8 | Q9P015 | MRPL15 | 0.67007 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 9 | Q9H6R3 | ACSS3 | 0.66799 | biosynthetic process GO:0009058 generation of precursor metabolites and energy GO:0006091 small molecule metabolic process GO:0044281 |
| 10 | Q8WY22 | BRI3BP | 0.66693 |
20 40 60 80 100 AA: MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQS STMI: DO_DISOPRED3: D...............................................................................DDDDDD.............. DO_IUPRED2A: ......................................DDDD.DDDDDDD......................DDDDDDDDDDD................. DO_SPOTD: DD.....................................................................DDDDDDDDDDDDDDDDD............ CONSENSUS: D.......................................................................DDDDDDDDDDDDDD.............. CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 200 AA: VAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDD............. DO_SPOTD: .............................................DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............. CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GltsaGrksrGlGkGhkfhhtiGG RICH_[R]: RemRgltsagRksR RICH_[GH]: GlGkGHkfHHtiGG RICH_[GK]: KsrGlGKGhK RICH_[GR]: RemRGltsaGRksRGlGkG
AA: HRYR STMI: DO_DISOPRED3: .... DO_IUPRED2A: .... DO_SPOTD: DDDD CONSENSUS: .... CONSENSUS_MOBI: ....