A6PVI3 NCB2L_HUMAN
Gene name: NCBP2L
Protein name: Nuclear cap-binding protein subunit 2-like
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62633 | CNBP | 0.88394 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q8TBK2 | SETD6 | 0.83965 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P61313 | RPL15 | 0.8226 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q86Y79 | PTRH1 | 0.77152 | |
| 5 | Q9H9A6 | LRRC40 | 0.77152 | |
| 6 | Q96BI1 | SLC22A18 | 0.77045 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q11130 | FUT7 | 0.76815 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 8 | O95484 | CLDN9 | 0.76281 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 9 | Q96QS1 | TSPAN32 | 0.75609 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
| 10 | Q9P015 | MRPL15 | 0.74294 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MSKDLKILCKDPALELSCYRDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFSRSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLT STMI: DO_DISOPRED3: DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD...D............................................................................................ CONSENSUS: DDDDDDDD............................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 AA: GTCLDEWIICTDWDVGFREGQQYGRGKSGGQVRDEFREDFHSGRGGFGRQTQI STMI: DO_DISOPRED3: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................DD........................ DO_SPOTD: ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................................... RICH_[F]: FredFhsgrggF RICH_[G]: GGqvrdefredfhsGrGGfG RICH_[R]: RgksggqvRdefRedfhsgR RICH_[GR]: RGksGGqvRdefRedfhsGR