P62633 CNBP_HUMAN
Gene name: CNBP
Protein name: Cellular nucleic acid-binding protein
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6PVI3 | NCBP2L | 0.88394 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | Q8TBK2 | SETD6 | 0.83233 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P61313 | RPL15 | 0.81438 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q96BI1 | SLC22A18 | 0.77235 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9H9A6 | LRRC40 | 0.77211 | |
| 6 | Q86Y79 | PTRH1 | 0.77211 | |
| 7 | Q11130 | FUT7 | 0.77106 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 8 | O95484 | CLDN9 | 0.76713 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 9 | Q96QS1 | TSPAN32 | 0.75019 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
| 10 | Q9P015 | MRPL15 | 0.73936 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYN STMI: DO_DISOPRED3: D.........................DDDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDDDD... DO_IUPRED2A: .............................DDDDD.................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D.........................DDDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDDDD... CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GmrsrGrGGftsdrG RICH_[R]: RgmRsRgRggftsdR RICH_[GR]: RGmRsRGRGGftsdRG RICH_fLPS_[F]: gFtsdrgFqF
120 140 160 AA: CGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA STMI: DO_DISOPRED3: .......................DDDDD..............................................DDD DO_IUPRED2A: ............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......................DDDDD..............................................DDD CONSENSUS_MOBI: .............................................................................