P61366 OSTN_HUMAN

Gene name: OSTN
Protein name: Osteocrin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- growth GO:0040007
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q12824 SMARCB1 0.70711 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
2 Q15669 RHOH 0.70711 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q16820 MEP1B 0.64018 response to stress GO:0006950
transport GO:0006810
4 Q5MNV8 FBXO47 0.57869
5 Q15546 MMD 0.57735 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
6 Q13103 SPP2 0.55601 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
transport GO:0006810
...
7 Q7Z6M3 MILR1 0.53916 immune system process GO:0002376
signal transduction GO:0007165
transport GO:0006810
...
8 Q13418 ILK 0.48507 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 Q6ZSC3 RBM43 0.4575
10 Q8IZ08 GPR135 0.39764

                                           20                  40                  60                  80                 100
AA:                      MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVD
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                         
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ..............................................D...DD.............................................D..
DO_SPOTD:                DD.....................DD.D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                          ...................DDDDDD.............................................D..
CONSENSUS_MOBI:                                     .........................................................................

                                          120       
AA:                      HKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
STMI:                                                     
DO_DISOPRED3:            ............................DDDDD
DO_IUPRED2A:             .DDDDDD.DDDD.......DDDDDD.DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .DDDDDDDDDDD.......DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................
RICH_[NR]:                                    RigRNRlsNsR