Q15669 RHOH_HUMAN
Gene name: RHOH
Protein name: Rho-related GTP-binding protein RhoH
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y2E5 | MAN2B2 | 0.70711 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 2 | Q96HU1 | SGSM3 | 0.70711 | catabolic process GO:0009056 cell cycle GO:0007049 protein transport GO:0015031 ... |
| 3 | Q14197 | MRPL58 | 0.6482 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 4 | Q6P4D5 | FAM122C | 0.55786 | |
| 5 | O60762 | DPM1 | 0.55216 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 6 | Q8IZ08 | GPR135 | 0.54957 | |
| 7 | Q9H7R5 | ZNF665 | 0.54677 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | P33681 | CD80 | 0.53877 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | Q5JQF7 | LINC01556 | 0.53606 | |
| 10 | Q9UNQ2 | DIMT1 | 0.53452 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
20 40 60 80 100 AA: MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIG STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: EIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF STMI: DO_DISOPRED3: ..........................................................................DDDDDDDDDDDD..... DO_IUPRED2A: ........................DDDD............................................................... DO_SPOTD: .........................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................................................DDDDDDDDDDDD..... CONSENSUS_MOBI: ........................................................................................... RICH_[NR]: RNRRRlfsiN RICH_fLPS_[R]: RRRnRRRlfs