P61574 RE113_HUMAN

Gene name: HERVK_113
Protein name: Endogenous retrovirus group K member 113 Rec protein

List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P61576 HERV-K104 0.98455 transport GO:0006810
2 P61578 ERVK-16 0.6402 transport GO:0006810
3 P49763 PGF 0.62075 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
4 Q8WYQ4 C22orf15 0.60164
5 P19237 TNNI1 0.5999 anatomical structure development GO:0048856
circulatory system process GO:0003013
6 Q9HAC8 UBTD1 0.58908
7 P12644 BMP4 0.57798 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q8TC36 SUN5 0.57777 anatomical structure development GO:0048856
cell differentiation GO:0030154
membrane organization GO:0061024
...
9 Q7L4I2 RSRC2 0.56131
10 Q9BSG1 ZNF2 0.56094 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSYGVPNSSEETAT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD...............................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD..DDDDDDDDDDDD..DD................DDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
RICH_[PR]:                 PsemqRkaPPRRRRhRnRaP                                                                              
RICH_[K]:                                         KmnKmvtseeqmKlpstKK                                                        
RICH_[M]:                                          MnkMvtseeqM                                                               
RICH_[R]:                       RkappRRRRhRnR                                                                                
RICH_[HR]:                           RRRRHRnRapltH                                                                           
RICH_fLPS_[R]:           mnpsemqRkappRRRRhRnR                                                                                
RICH_MOBI_[K]:                                    KmnKmvtseeqmKlpstKK                                                        
RICH_MOBI_[M]:                                     MnkMvtseeqM                                                               
RICH_MOBI_[R]:                  RkappRRRRhRnR                                                                                
RICH_MOBI_[HR]:                      RRRRHRnRapltH                                                                           
RICH_MOBI_[KM]:                                   KMnKMvtseeqMKlpstKK                                                        
RICH_MOBI_[MR]:          MnpseMqRkappRRRRhRnR                                                                                
RICH_fLPS_MOBI_[R]:      mnpsemqRkappRRRRhRnR                                                                                
RICH_fLPS_MOBI_[M]:                            lthkMnkMvtseeqM                                                               

                                        
AA:                      IENGP
STMI:                         
DO_DISOPRED3:            ....D
DO_IUPRED2A:             DDDDD
DO_SPOTD:                DDDDD
CONSENSUS:               DDDDD
CONSENSUS_MOBI:          .....