P61576 REC04_HUMAN

Gene name: HERV-K104
Protein name: Endogenous retrovirus group K member 104 Rec protein

List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P61574 HERVK_113 0.98455 transport GO:0006810
2 P49763 PGF 0.62742 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 P61578 ERVK-16 0.62245 transport GO:0006810
4 P19237 TNNI1 0.62096 anatomical structure development GO:0048856
circulatory system process GO:0003013
5 Q8WYQ4 C22orf15 0.56516
6 Q8TC36 SUN5 0.56361 anatomical structure development GO:0048856
cell differentiation GO:0030154
membrane organization GO:0061024
...
7 P12644 BMP4 0.55748 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q9HAC8 UBTD1 0.55281
9 Q8IX29 FBXO16 0.55045
10 O95025 SEMA3D 0.53948 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60                  80                 100
AA:                      MNPSEMQRKAPPRRRRHCNRAPLTHKMNKMVTSEEEMKLPSTKKAEPLTWAQLKKLTQLATKCLENTKVTQTPESMLLAALMIVSMVSAGVTNSSKETAT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD...............................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDD..D..............D.DDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................
RICH_[PR]:                 PsemqRkaPPRRRRhcnRaP                                                                              
RICH_[K]:                                         KmnKmvtseeemKlpstKK                                                        
RICH_[M]:                                          MnkMvtseeeM                                                               
RICH_[R]:                       RkappRRRRhcnR                                                                                
RICH_[EM]:                                         MnkMvtsEEEM                                                               
RICH_[HR]:                           RRRRHcnRapltH                                                                           
RICH_fLPS_[R]:           mnpsemqRkappRRRRhcnR                                                                                
RICH_MOBI_[K]:                                    KmnKmvtseeemKlpstK                                                         
RICH_MOBI_[M]:                                     MnkMvtseeeM                                                               
RICH_MOBI_[R]:                  RkappRRRRhcnR                                                                                
RICH_MOBI_[HR]:                      RRRRHcnRapltH                                                                           
RICH_MOBI_[KM]:                                   KMnKMvtseeeMKlpstK                                                         
RICH_MOBI_[MR]:          MnpseMqRkappRRRRhcnR                                                                                
RICH_fLPS_MOBI_[R]:           mqRkappRRRRhcnR                                                                                
RICH_fLPS_MOBI_[M]:                            lthkMnkMvtseeeM                                                               

                                        
AA:                      IENGP
STMI:                         
DO_DISOPRED3:            ....D
DO_IUPRED2A:             DDDDD
DO_SPOTD:                DDDDD
CONSENSUS:               DDDDD
CONSENSUS_MOBI:          .....