P61578 REC16_HUMAN

Gene name: ERVK-16
Protein name: Endogenous retrovirus group K member 16 Rec protein

List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P61574 HERVK_113 0.6402 transport GO:0006810
2 P61576 HERV-K104 0.62245 transport GO:0006810
3 Q8WYQ4 C22orf15 0.47747
4 Q8TC36 SUN5 0.45239 anatomical structure development GO:0048856
cell differentiation GO:0030154
membrane organization GO:0061024
...
5 Q86V25 VASH2 0.41452 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q9NS28 RGS18 0.41344 signal transduction GO:0007165
7 O43709 BUD23 0.40766 cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
ribosome biogenesis GO:0042254
8 Q9HCX4 TRPC7 0.40723 homeostatic process GO:0042592
reproduction GO:0000003
response to stress GO:0006950
...
9 Q9UNQ2 DIMT1 0.40647 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 P48556 PSMD8 0.40564 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MNPSEMQRKAPPRRRRHRNRAPSSHKMNKMMMSEEQMKLPSTNKAEPLTWAQLNKLTQLATKCLENTKMTQTPESMLLAALMIVSTVSAGVPNSSEETVT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD..D..........................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DD.DDDDDDDDDDDDDDDDDDDDDD..D...DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDD....
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................DDDDDDD....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
RICH_[PR]:                 PsemqRkaPPRRRRhRnRaP                                                                              
RICH_[K]:                                         KmnKmmmseeqmKlpstnK                                                        
RICH_[M]:                                          MnkMMMseeqM                                                               
RICH_[R]:                       RkappRRRRhRnR                                                                                
RICH_[HM]:                               HrnrapssHkMnkMM                                                                     
RICH_[HR]:                           RRRRHRnRapssH                                                                           
RICH_[KM]:                                        KMnKMMMseeqMKlpstnK                                                        
RICH_[MR]:                           RRRRhRnRapsshkMnkMMM                                                                    
RICH_fLPS_[R]:           mnpsemqRkappRRRRhRnR                                                                                
RICH_fLPS_[MR]:               MqRkappRRRRhRnRapsshkMnkMMM                                                                    
RICH_fLPS_[M]:                            rnrapsshkMnkMMMseeqM                                                               
RICH_MOBI_[M]:                                     MnkMMMseeqM                                                               
RICH_MOBI_[R]:                  RkappRRRRhRnR                                                                                
RICH_MOBI_[HM]:                          HrnrapssHkMnkMM                                                                     
RICH_MOBI_[HR]:                      RRRRHRnRapssH                                                                           
RICH_MOBI_[MR]:          MnpseMqRkappRRRRhRnR                                                                                
RICH_fLPS_MOBI_[R]:      mnpsemqRkappRRRRhRnR                                                                                
RICH_fLPS_MOBI_[MR]:          MqRkappRRRRhRnRapsshkMnkMMM                                                                    
RICH_fLPS_MOBI_[M]:                       rnrapsshkMnkMMMseeqM                                                               

                                        
AA:                      IENGP
STMI:                         
DO_DISOPRED3:            ....D
DO_IUPRED2A:             DDDDD
DO_SPOTD:                .DDDD
CONSENSUS:               .DDDD
CONSENSUS_MOBI:          .....