P61956 SUMO2_HUMAN
Gene name: SUMO2
Protein name: Small ubiquitin-related modifier 2
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NR50 | EIF2B3 | 0.88774 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | P32456 | GBP2 | 0.78488 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | O95302 | FKBP9 | 0.76822 | protein folding GO:0006457 |
| 4 | Q8TCT8 | SPPL2A | 0.73994 | immune system process GO:0002376 signal transduction GO:0007165 |
| 5 | Q00688 | FKBP3 | 0.71778 | |
| 6 | P38405 | GNAL | 0.70711 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 7 | Q8TAA3 | PSMA8 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | A6NHJ4 | ZNF860 | 0.67572 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P46721 | SLCO1A2 | 0.647 | transport GO:0006810 |
| 10 | Q9NS73 | MBIP | 0.63372 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 response to stress GO:0006950 ... |
20 40 60 80 AA: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY STMI: DO_DISOPRED3: DDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDD..D........ DO_SPOTD: DDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: ............................................................................................... RICH_[EK]: EKpKEgvKtE