P62263 RS14_HUMAN
Gene name: RPS14
Protein name: 40S ribosomal protein S14
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- immune system process GO:0002376
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96CU9 | FOXRED1 | 0.96506 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 2 | A0A1B0GTL2 | C20orf204 | 0.92381 | |
| 3 | Q08462 | ADCY2 | 0.88365 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q9P015 | MRPL15 | 0.84916 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 5 | Q96S16 | JMJD8 | 0.82369 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NUL7 | DDX28 | 0.8165 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 7 | Q86Y79 | PTRH1 | 0.8165 | |
| 8 | Q96BI1 | SLC22A18 | 0.81537 | transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | P33681 | CD80 | 0.81383 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 10 | Q11130 | FUT7 | 0.81293 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 80 100 AA: MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRAT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD........................................DDDD...D.D.DD..DD........................DD DO_SPOTD: DDDDDDDDDDDDDDDDDD...DD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: DDDDDDDDDDD.........................................................................................
120 140 AA: GGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL STMI: DO_DISOPRED3: ..........................................DDDDDDDDD DO_IUPRED2A: DDDDDDDDDDDDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: .....................................DDDDDDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................... RICH_[R]: RRkggRRgRR RICH_[GR]: RRkGGRRGRR RICH_fLPS_[R]: RRkggRRgRR