P62834 RAP1A_HUMAN
Gene name: RAP1A
Protein name: Ras-related protein Rap-1A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- protein transport GO:0015031
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P1P4 | TAAR3P | 0.83205 | nervous system process GO:0050877 |
| 2 | Q99578 | RIT2 | 0.80644 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | Q9UK45 | LSM7 | 0.76805 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 4 | O95347 | SMC2 | 0.68164 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 5 | P60002 | ELOF1 | 0.67097 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 6 | Q14CX7 | NAA25 | 0.64972 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 7 | Q13609 | DNASE1L3 | 0.62877 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 8 | Q8WW27 | APOBEC4 | 0.62877 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 9 | O14807 | MRAS | 0.60187 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 10 | Q00013 | MPP1 | 0.59281 | immune system process GO:0002376 signal transduction GO:0007165 |
20 40 60 80 100 AA: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI STMI: DO_DISOPRED3: ..............................................................DD.................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: LRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKSCLLL STMI: DO_DISOPRED3: .......................................................................DDDDDDDDD...D DO_IUPRED2A: .....................................................................D.............. DO_SPOTD: ....................................................................DDDDDDDDDDDDDDDD CONSENSUS: .....................................................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................... RICH_[KL]: KpKKKscLLL RICH_fLPS_[K]: pveKKKpKKKsclll