Q9UK45 LSM7_HUMAN

Gene name: LSM7
Protein name: U6 snRNA-associated Sm-like protein LSm7

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9P1P4 TAAR3P 0.92308 nervous system process GO:0050877
2 P30101 PDIA3 0.89565 cell death GO:0008219
homeostatic process GO:0042592
immune system process GO:0002376
...
3 A0A1B0GTY4 TEX50 0.78899
4 P62834 RAP1A 0.76805 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 O95347 SMC2 0.75621 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
6 P60002 ELOF1 0.74437 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
7 Q9NRQ5 SMCO4 0.72205
8 Q14CX7 NAA25 0.7208 cellular protein modification process GO:0006464
protein maturation GO:0051604
9 Q8N4N3 KLHL36 0.71714 cellular protein modification process GO:0006464
10 P42127 ASIP 0.70122 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDD.........................................................................................D
DO_IUPRED2A:             DD........................................................DD..................................DDD...
DO_SPOTD:                DDDDDDDDDD.......................................................................................DDD
CONSENSUS:               DDDDDDDDDD.........................................................................................D
CONSENSUS_MOBI:          DDDDDDDDDD...............................................................................DDDDDDDDDDD
RICH_fLPS_[K]:           madKeKKKKe                                                                                          
RICH_fLPS_MOBI_[K]:      madKeKKKKe                                                                                          

                                          
AA:                      QDA
STMI:                       
DO_DISOPRED3:            DDD
DO_IUPRED2A:             ...
DO_SPOTD:                DDD
CONSENSUS:               DDD
CONSENSUS_MOBI:          DDD