Q8N2Z9 CENPS_HUMAN

Gene name: CENPS
Protein name: Centromere protein S

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- DNA metabolic process GO:0006259
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NYL4 FKBP11 1
2 Q8N9C0 IGSF22 1
3 P43308 SSR2 1 anatomical structure development GO:0048856
embryo development GO:0009790
protein targeting GO:0006605
...
4 O14807 MRAS 0.99973 anatomical structure development GO:0048856
cytoskeleton organization GO:0007010
signal transduction GO:0007165
5 Q13609 DNASE1L3 0.99746 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
6 Q8WW27 APOBEC4 0.99746 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
7 Q9HAW9 UGT1A8 0.99589 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
8 P62979 RPS27A 0.99589 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q14CX7 NAA25 0.99388 cellular protein modification process GO:0006464
protein maturation GO:0051604
10 Q00059 TFAM 0.99388 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDD.........................................................................................
DO_IUPRED2A:             DDDDDDDDDDDD...................................................................DD...................
DO_SPOTD:                DDDDDDDDDDDD........................................................................................
CONSENSUS:               DDDDDDDDDDDD........................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120  
AA:                      EEIAQINLERKAQKKKKSEDGSKNSRQPAEAGVVESEN
STMI:                                                          
DO_DISOPRED3:            ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................DDDDDDDDDDDDDDDDDDDD
RICH_[K]:                          KaqKKKKsedgsK               
RICH_fLPS_[K]:                     KaqKKKKsedgsK