P78537 BL1S1_HUMAN
Gene name: BLOC1S1
Protein name: Biogenesis of lysosome-related organelles complex 1 subunit 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- cytoskeleton-dependent intracellular transport GO:0030705
- generation of precursor metabolites and energy GO:0006091
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A8MQB3 | LINC02693 | 0.80071 | |
| 2 | Q5TEA3 | C20orf194 | 0.72763 | |
| 3 | Q9BZG8 | DPH1 | 0.72605 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | O95922 | TTLL1 | 0.72049 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | Q86VQ6 | TXNRD3 | 0.71798 | anatomical structure development GO:0048856 cell differentiation GO:0030154 homeostatic process GO:0042592 ... |
| 6 | P28062 | PSMB8 | 0.71735 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 7 | A1L168 | C20orf202 | 0.70522 | |
| 8 | Q8NFW8 | CMAS | 0.70353 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | P0DP75 | MED14OS | 0.7008 | |
| 10 | P26006 | ITGA3 | 0.69546 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.......................D...................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDD.............................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD..DDDDDD.......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDD...................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[PR]: RgeRssfRsRRgPgvPsPqP RICH_[RS]: SRgeRSSfRS RICH_[R]: RgeRssfRsRR RICH_[GR]: GsRGeRssfRsRRGpG RICH_MOBI_[PV]: PgVPsPqPdV RICH_MOBI_[RS]: SRgeRSSfRS RICH_MOBI_[R]: RgeRssfRsRR RICH_MOBI_[GR]: GsRGeRssfRsRRGpG
120 140 AA: QTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS STMI: DO_DISOPRED3: ...............................................DDDDDD DO_IUPRED2A: ..................................................... DO_SPOTD: ..............................................DDDDDDD CONSENSUS: ...............................................DDDDDD CONSENSUS_MOBI: .....................................................