P78543 BTG2_HUMAN
Gene name: BTG2
Protein name: Protein BTG2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- nervous system process GO:0050877
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IUN9 | CLEC10A | 0.8695 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 2 | P37058 | HSD17B3 | 0.77969 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 reproduction GO:0000003 ... |
| 3 | P33260 | CYP2C18 | 0.67397 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 4 | P11712 | CYP2C9 | 0.65937 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9BVV7 | TIMM21 | 0.65717 | cellular component assembly GO:0022607 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 6 | A0A0K2S4Q6 | CD300H | 0.65488 | immune system process GO:0002376 |
| 7 | Q99679 | GPR21 | 0.65218 | growth GO:0040007 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 8 | Q9UHD4 | CIDEB | 0.64018 | cell death GO:0008219 protein maturation GO:0051604 response to stress GO:0006950 ... |
| 9 | Q6P9F5 | TRIM40 | 0.64018 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P54756 | EPHA5 | 0.6391 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSEL STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: DD.................................................................................................. DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 AA: TLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS STMI: DO_DISOPRED3: ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .......................................................... DO_SPOTD: ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...........................D.............................. RICH_[L]: LLtcknqvLL RICH_[CL]: CgLLtCknqvLL