Q6P9F5 TRI40_HUMAN
Gene name: TRIM40
Protein name: Tripartite motif-containing protein 40
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q53F39 | MPPE1 | 0.90213 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 transport GO:0006810 ... |
| 2 | O14638 | ENPP3 | 0.8974 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 3 | P50391 | NPY4R | 0.88492 | signal transduction GO:0007165 |
| 4 | Q9H720 | CWH43 | 0.81373 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q9HD23 | MRS2 | 0.73849 | small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | P00387 | CYB5R3 | 0.7313 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 ... |
| 7 | P42785 | PRCP | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 circulatory system process GO:0003013 ... |
| 8 | A0A1B0GUV8 | LOC102723971 | 0.70711 | |
| 9 | Q9UI14 | RABAC1 | 0.70711 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | Q8NH81 | OR10G6 | 0.69048 |
20 40 60 80 100 AA: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHM STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: DD.................................................................................................. DO_SPOTD: DDDDDDDDD........................................................................................... CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: SHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .....DD..............................................DDDDDDDDDDDDDDDDDD............................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: QLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL STMI: DO_DISOPRED3: ..........................................DDDDDDDDDDDDDDDD DO_IUPRED2A: ...............D.DDDDDDDDDDD.............................. DO_SPOTD: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................................... RICH_[L]: LekgvseLLL