O15503 INSI1_HUMAN

Gene name: INSIG1
Protein name: Insulin-induced gene 1 protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- homeostatic process GO:0042592
- membrane organization GO:0061024
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96G91 P2RY11 0.80252 response to stress GO:0006950
signal transduction GO:0007165
2 H3BQW9 FAM229A 0.79491
3 P51817 PRKX 0.79032 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 P28072 PSMB6 0.78191 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 P50440 GATM 0.78145 anatomical structure development GO:0048856
biosynthetic process GO:0009058
homeostatic process GO:0042592
...
6 Q3LXA3 TKFC 0.76827 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
immune system process GO:0002376
...
7 P57086 SCAND1 0.76623
8 P10415 BCL2 0.76314 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
9 Q01581 HMGCS1 0.7631 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9NQT5 EXOSC3 0.76201 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLAL
STMI:                                                                                                           MMMMMMMMMMMMM
DO_DISOPRED3:            D..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_IUPRED2A:             .......................DDDD.........................DDD..DDDDDDDDDDDDDDDD....D......................
DO_SPOTD:                DDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
CONSENSUS:               D..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........             
CONSENSUS_MOBI:          ..................................................DDDDDDDDDDDDDDDDDDDDDDD..............             
RICH_[AP]:                                                           PsllAAhgAPdAdPAP                                        
RICH_[AR]:                               ARRRgppRAsAAglAA                                                                    
RICH_[A]:                                ArrrgpprAsAAglAA                AAhgApdAdpAprgrsAA                                  
RICH_[P]:                                                                         PaPrgrsaamsgPePgsPyP                       
RICH_fLPS_[A]:                                 prAsAAglAA              llAAhgApdAdpAprgrsAA                                  
RICH_MOBI_[A]:                                                               ApdAdpAprgrsAA                                  

                                          120                 140                 160                 180                 200
AA:                      VLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGL
STMI:                    MMMMMMMM                  MMMMMMMMMMMMMMMMMMMMM             MMMMMMMMMMMMMMMMM     MMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:                       ..................                     .............                 .....                  
CONSENSUS_MOBI:                  ..................                     .............                 .....                  

                                          220                 240                 260   
AA:                      WWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
STMI:                    MMM      MMMMMMMMMMMMMMMMMMMMM           MMMMMMMMMMMMMMMMMMMMM               
DO_DISOPRED3:            ......................................................................DDDDDDD
DO_IUPRED2A:             ............................................................................D
DO_SPOTD:                .....................................................................DDDDDDDD
CONSENSUS:                  ......                     ...........                     ........DDDDDDD
CONSENSUS_MOBI:             ......                     ...........                     ...............