Q8N9H6 CH031_HUMAN

Gene name: C8orf31
Protein name: Putative uncharacterized protein C8orf31

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5GJ75 TNFAIP8L3 0.77599 cell death GO:0008219
cellular protein modification process GO:0006464
signal transduction GO:0007165
...
2 Q01524 DEFA6 0.67002 immune system process GO:0002376
response to stress GO:0006950
3 Q9H845 ACAD9 0.61663 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
small molecule metabolic process GO:0044281
4 P0CG22 DHRS4L1 0.55171
5 Q8NBP5 MFSD9 0.5456
6 P26373 RPL13 0.53462 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q99758 ABCA3 0.53349 transmembrane transport GO:0055085
transport GO:0006810
8 A6NJ08 MBD3L5 0.5321 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 Q96LR9 APOLD1 0.52587 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q8NHZ7 MBD3L2 0.52047 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MAEKPHQNSCNSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTTALNLPSALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDD...........................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDD........DDDDDDD..DDDDDDDD.DDDD....DDDD...D....D....DDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD........DDDDDDDDDDDDDDDDDDDDDD....DDDDDDDD....D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AD]:                                                                                           DAhflgDtDpiqegArDhAA    
RICH_[AR]:                                        RdRgscthRAqgllAARttA                                                       
RICH_[A]:                                                                                                          ArdhAAggpf
RICH_[D]:                                                                                            DahflgDtDpiqegarD       
RICH_[R]:                                         RdRgscthRaqgllaaR                                                          
RICH_[HR]:                                       HRdRgsctHR                                                                  

                                          120        
AA:                      QDRQASVAAQTLSWERGQGFSRHHGNHLLYSH
STMI:                                                    
DO_DISOPRED3:            ........................DDDDDDDD
DO_IUPRED2A:             DDD.DDDDD.DDDDDDDD......DD....D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD......DDDDDDDD
CONSENSUS_MOBI:          ................................
RICH_[AQ]:               QdrQAsvAAQ                      
RICH_[A]:                qdrqAsvAA                       
RICH_[Q]:                QdrQasvaaQtlswergQ