Q07627 KRA11_HUMAN
Gene name: KRTAP1-1
Protein name: Keratin-associated protein 1-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y263 | PLAA | 1 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9UK05 | GDF2 | 0.99967 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q9Y3D2 | MSRB2 | 0.99862 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 4 | Q8NHA8 | OR1F12 | 0.9778 | signal transduction GO:0007165 |
| 5 | Q6ZTR6 | ZNF516-DT | 0.90216 | |
| 6 | P04632 | CAPNS1 | 0.88227 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | P54652 | HSPA2 | 0.87912 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | Q14576 | ELAVL3 | 0.86138 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q5UCC4 | EMC10 | 0.85863 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 10 | Q9BUN8 | DERL1 | 0.84119 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSCCQPSCCETSCCQPSCYQTSSCGTGCGIGGG STMI: DO_DISOPRED3: ...........................................................................................DDD.D.DDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................................................................DDDDD.DDD CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GGG RICH_fLPS_[G]: GGG
120 140 160 AA: IGYGQEGSSGAVSTRIRWCRPDCRVEGTCLPPCCVVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEPTC STMI: DO_DISOPRED3: DDDDDD.D..................................................................... DO_IUPRED2A: ............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..... CONSENSUS: DDDDDDDD..................................................................... CONSENSUS_MOBI: ............................................................................. RICH_[G]: iGyGqeG RICH_fLPS_[G]: iGyGqeG