Q13232 NDK3_HUMAN
Gene name: NME3
Protein name: Nucleoside diphosphate kinase 3
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P26012 | ITGB8 | 0.43869 | |
| 2 | O14944 | EREG | 0.4353 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | P53582 | METAP1 | 0.38517 | |
| 4 | Q13535 | ATR | 0.37274 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | O94822 | LTN1 | 0.36706 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P17752 | TPH1 | 0.36181 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | P57054 | PIGP | 0.35238 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | P20701 | ITGAL | 0.34678 | biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 extracellular matrix organization GO:0030198 ... |
| 9 | Q96HI0 | SENP5 | 0.34188 | cell cycle GO:0007049 cell division GO:0051301 cellular protein modification process GO:0006464 |
| 10 | Q92621 | NUP205 | 0.33459 | biological process involved in symbiotic interaction GO:0044403 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDV STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDD..DDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD................................................................................... RICH_[FL]: LvLtiFanLF RICH_MOBI_[C]: ClvltifanlfpaaC RICH_MOBI_[CF]: ClvltiFanlFpaaC RICH_MOBI_[CL]: CLvLtifanLfpaaC RICH_MOBI_[FI]: IclvltIFanlF RICH_MOBI_[FL]: LvLtiFanLF RICH_MOBI_[IL]: IcLvLtIfanL
120 140 160 AA: VRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE STMI: DO_DISOPRED3: ..................................................................... DO_IUPRED2A: ..................................................................... DO_SPOTD: ..................................................................... CONSENSUS: ..................................................................... CONSENSUS_MOBI: .....................................................................