Q13956 CNCG_HUMAN

Gene name: PDE6H
Protein name: Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- nervous system process GO:0050877
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P18545 PDE6G 0.79494 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
nervous system process GO:0050877
...
2 Q14696 MESD 0.63186 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
3 Q9Y5G9 PCDHGA4 0.62195 cell adhesion GO:0007155
reproduction GO:0000003
4 P09132 SRP19 0.59496 cellular component assembly GO:0022607
protein targeting GO:0006605
protein transport GO:0015031
...
5 O15031 PLXNB2 0.55993 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 P25942 CD40 0.55786 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q8TC29 ENKUR 0.54385
8 A6NHR8 FAM47DP 0.54377
9 P48167 GLRB 0.5423 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
10 Q9ULV1 FZD4 0.54229 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 
AA:                      MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII
STMI:                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS_MOBI:          DD.................................................................................
RICH_[PQ]:                            QgPttPrkgPPkfkQrQtrQ                                                  
RICH_[PT]:                   TTlPaPasnqgPTTPrkgPP                                                           
RICH_[G]:                                                         GvkGfGddipGmeG                            
RICH_[K]:                                    KgppKfKqrqtrqfKsKppKKgvK                                       
RICH_[P]:                       PaPasnqgPttPrkgPP                                                           
RICH_[Q]:                             QgpttprkgppkfkQrQtrQ                                                  
RICH_[T]:                    TTlpapasnqgpTT                                                                 
RICH_[FK]:                                                FKsKppKKgvKgF                                     
RICH_[GK]:                                                 KsKppKKGvKGfGddipGmeG                            
RICH_[KP]:                              PttPrKgPPKfKqrqtrqfK                                                
RICH_[KQ]:                                         KQrQtrQfKsKppKK                                          
RICH_fLPS_[K]:                                   KfKqrqtrqfKsKppKKgvK