P09132 SRP19_HUMAN

Gene name: SRP19
Protein name: Signal recognition particle 19 kDa protein

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P18545 PDE6G 0.73973 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
nervous system process GO:0050877
...
2 H3BMG3 SMKR1 0.71151
3 A6NIV6 LRRIQ4 0.69894
4 P39748 FEN1 0.6907 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
5 P61247 RPS3A 0.67066 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 Q9ULV1 FZD4 0.67063 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
7 O76094 SRP72 0.66222 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
8 Q15291 RBBP5 0.64724 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 O00585 CCL21 0.64387 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
10 O95995 GAS8 0.64349 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDD..........................................................DDDD.........................
DO_IUPRED2A:             .................................DD....DD...........................................................
DO_SPOTD:                DDDDDDDDD...........................................................................................
CONSENSUS:               DDDDDDDDD...........................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                
AA:                      RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
STMI:                                                                
DO_DISOPRED3:            ................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................DDDDDDDDDDDDDDDDDD
RICH_[G]:                                      GGadqslqqGeGskkGkG    
RICH_[K]:                                    KtggadqslqqgegsKKgKgKKKK
RICH_[Q]:                                   QktggadQslQQ             
RICH_[GK]:                                   KtGGadqslqqGeGsKKGKGKKKK
RICH_[GQ]:                                  QktGGadQslQQGeGskkG      
RICH_[KQ]:                                  QKtggadQslQQgegsKKgK     
RICH_fLPS_[K]:                                        qqgegsKKgKgKKKK
RICH_MOBI_[GK]:                                         GeGsKKGKGKKKK
RICH_fLPS_MOBI_[K]:                                        sKKgKgKKKK