P18545 CNRG_HUMAN

Gene name: PDE6G
Protein name: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- nervous system process GO:0050877
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13956 PDE6H 0.79494 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165
2 Q14696 MESD 0.74796 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
3 P09132 SRP19 0.73973 cellular component assembly GO:0022607
protein targeting GO:0006605
protein transport GO:0015031
...
4 Q96HU8 DIRAS2 0.71721 signal transduction GO:0007165
5 Q9H0R5 GBP3 0.71179 immune system process GO:0002376
response to stress GO:0006950
6 Q8TC29 ENKUR 0.65575
7 P25942 CD40 0.65481 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q8N300 SVBP 0.64652 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
9 Q9ULV1 FZD4 0.61694 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
10 Q9Y5G9 PCDHGA4 0.61086 cell adhesion GO:0007155
reproduction GO:0000003

                                           20                  40                  60                  80             
AA:                      MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
STMI:                                                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS_MOBI:          .......................................................................................
RICH_[G]:                                                             GvqGfGddipGmeG                            
RICH_[K]:                                        KgppKfKqrqtrqfKsKppKK                                          
RICH_[Q]:                                               QrQtrQfkskppkkgvQ                                       
RICH_[GK]:                                                     KsKppKKGvqGfGddipG                               
RICH_[KP]:                                  PvtPrKgPPKfKqrqtrqfK                                                
RICH_[KQ]:                                           KfKQrQtrQfKsKppKKgvQ                                       
RICH_fLPS_[K]:                                   KgppKfKqrqtrqfKsKppKK