Q14206 RCAN2_HUMAN
Gene name: RCAN2
Protein name: Calcipressin-2
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A4QMS7 | C5orf49 | 0.76298 | |
| 2 | Q13231 | CHIT1 | 0.68872 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 immune system process GO:0002376 ... |
| 3 | O60890 | OPHN1 | 0.68504 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 4 | Q5VTD9 | GFI1B | 0.67968 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | Q99576 | TSC22D3 | 0.67456 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q6UX34 | SNORC | 0.66898 | anatomical structure development GO:0048856 |
| 7 | Q15459 | SF3A1 | 0.65984 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 8 | Q96FZ7 | CHMP6 | 0.64185 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 9 | Q9H5V8 | CDCP1 | 0.64111 | |
| 10 | Q99755 | PIP5K1A | 0.64015 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHL STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .............................................................................................DDDDDDD DO_SPOTD: DDDDDDD...................................................................................DDDDDDDDD. CONSENSUS: DDDDDD.......................................................................................DDDDDDD CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: APPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSN STMI: DO_DISOPRED3: ...................................................DDDD.....DD.....DDDDDDDDDDD..................D DO_IUPRED2A: D..DD.DDDDDDD......DDDDD.......................DDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: D..................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D..................................................DDD......DD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[P]: PktsPkPkiiqtrrPglPP RICH_[EP]: EEEEdPktsPkPkiiqtrrP RICH_[IP]: PkPkIIqtrrPglPP RICH_MOBI_[P]: PktsPkPkiiqtrrPglPP RICH_MOBI_[EI]: IEEEEdpktspkpkII RICH_MOBI_[IP]: PktsPkPkIIqtrrPglPP