Q15286 RAB35_HUMAN
Gene name: RAB35
Protein name: Ras-related protein Rab-35
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell division GO:0051301
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NFN9 | ANKUB1 | 0.96175 | |
| 2 | Q96HU8 | DIRAS2 | 0.80759 | signal transduction GO:0007165 |
| 3 | O95340 | PAPSS2 | 0.79888 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q9H0R5 | GBP3 | 0.7765 | immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q9UL01 | DSE | 0.76098 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 6 | Q8N9S9 | SNX31 | 0.65426 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | Q8N300 | SVBP | 0.63359 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 8 | P21246 | PTN | 0.62051 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 9 | Q49AG3 | ZBED5 | 0.61813 | |
| 10 | P49917 | LIG4 | 0.61602 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVK STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: RWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC STMI: DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................................................................DD..DDD........... DO_SPOTD: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS_MOBI: ..............................................................................DD.................... RICH_[K]: KqqqqqqndvvKltKnsKrKK RICH_[KQ]: KQQQQQQndvvKltKnsKrKK RICH_fLPS_[Q]: lakQQQQQQndvvkltknsk RICH_fLPS_[K]: KltKnsKrKK
AA: C STMI: DO_DISOPRED3: D DO_IUPRED2A: . DO_SPOTD: . CONSENSUS: . CONSENSUS_MOBI: .