Q96HU8 DIRA2_HUMAN
Gene name: DIRAS2
Protein name: GTP-binding protein Di-Ras2
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H0R5 | GBP3 | 0.98914 | immune system process GO:0002376 response to stress GO:0006950 |
| 2 | Q9BZA0 | TTTY10 | 0.8165 | |
| 3 | Q9NYL4 | FKBP11 | 0.8165 | |
| 4 | O14807 | MRAS | 0.81628 | anatomical structure development GO:0048856 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 5 | Q8WW27 | APOBEC4 | 0.81442 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 6 | Q13609 | DNASE1L3 | 0.81442 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | Q9HAW9 | UGT1A8 | 0.81314 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 8 | P62979 | RPS27A | 0.81314 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q14CX7 | NAA25 | 0.8115 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 10 | Q00059 | TFAM | 0.8115 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPI STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDDD................................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: YEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM STMI: DO_DISOPRED3: ............................................................................DDDDDDDDDDDDDDDDDDD.... DO_IUPRED2A: .............................DDD.D............................................DDD...D.............. DO_SPOTD: ..........................................................................DDDDDDDDDDDDDDDDDDDDD.... CONSENSUS: ............................................................................DDDDDDDDDDDDDDDDDDD.... CONSENSUS_MOBI: .........DDD....................................................................................... RICH_[K]: KKsKqqKrKeKlKgK RICH_[KQ]: QidgKKsKQQKrKeK RICH_fLPS_[K]: KKsKqqKrKeKlKgK