Q8N300 SVBP_HUMAN

Gene name: SVBP
Protein name: Small vasohibin-binding protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P35268 RPL22 0.82432 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9H0R5 GBP3 0.80398 immune system process GO:0002376
response to stress GO:0006950
3 Q92664 GTF3A 0.79783 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 Q96HU8 DIRAS2 0.78737 signal transduction GO:0007165
5 Q8NEL0 CCDC54 0.75822
6 P49917 LIG4 0.75774 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q9HAW9 UGT1A8 0.75764 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
8 P62979 RPS27A 0.75764 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 P21246 PTN 0.75562 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
10 Q9NYL4 FKBP11 0.75185

                                           20                  40                  60              
AA:                      MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
STMI:                                                                                      
DO_DISOPRED3:            DDDDDDDDDDDDD.D..DD..............................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DD.........DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDD........................................DDDDDDD
RICH_[K]:                      KeKtKvKesvsrveKaKqKsaqqelK                                  
RICH_[Q]:                                       QksaQQelkQ                                 
RICH_[KQ]:                                   KaKQKsaQQelKQ                                 
RICH_[KV]:                     KeKtKVKesVsrVeK                                             
RICH_fLPS_[K]:                rKeKtKvKesvsrveKaKqK                                         
RICH_MOBI_[KV]:                KeKtKVKesV