Q15543 TAF13_HUMAN
Gene name: TAF13
Protein name: Transcription initiation factor TFIID subunit 13
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HCJ6 | VAT1L | 0.70206 | |
| 2 | P68363 | TUBA1B | 0.67622 | cell cycle GO:0007049 cell division GO:0051301 cytoskeleton organization GO:0007010 ... |
| 3 | Q71U36 | TUBA1A | 0.66065 | cell cycle GO:0007049 cell division GO:0051301 cell junction organization GO:0034330 ... |
| 4 | P40337 | VHL | 0.64076 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 5 | O95633 | FSTL3 | 0.63428 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | A0A1W2PR82 | PERCC1 | 0.61716 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | Q8IZU1 | FAM9A | 0.61426 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | A6NDB9 | PALM3 | 0.60685 | signal transduction GO:0007165 |
| 9 | Q8WZ59 | TMEM190 | 0.60295 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 10 | Q9UFB7 | ZBTB47 | 0.59184 | response to stress GO:0006950 |
20 40 60 80 100 AA: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDDD RICH_[E]: EEEdptfEEEnEEigggaE RICH_[EG]: EEEdptfEEEnEEiGGGaEGGqG RICH_fLPS_[EG]: EEEdptfEEEnEEiGGGaEGGqG RICH_fLPS_[E]: dEEEdptfEEEnEEigggaE RICH_fLPS_[G]: eeneeiGGGaeGGqG RICH_MOBI_[E]: EEEdptfEEEnEEigggaE RICH_MOBI_[F]: FlirkdprkF RICH_MOBI_[K]: KdprKfarv RICH_MOBI_[R]: RqgRvqvedivfliRkdpR RICH_MOBI_[V]: VqVediVflirkdprkfarV RICH_MOBI_[EG]: EEEdptfEEEnEEiGGGaEGGqG RICH_MOBI_[FI]: IvFlIrkdprkF RICH_MOBI_[FR]: RvqvedivFliRkdpRkFaR RICH_MOBI_[FV]: VqVediVFlirkdprkFarV RICH_MOBI_[IR]: RqgRvqvedIvflIRkdpR RICH_MOBI_[IV]: VqVedIVflIrkdprkfarV RICH_fLPS_MOBI_[EG]: EEEdptfEEEnEEiGGGaEGG RICH_fLPS_MOBI_[E]: adEEEdptfEEEnEEigggaE RICH_fLPS_MOBI_[G]: eeneeiGGGaeGGqG
120 AA: KDLLTMNEELKRARKAFDEANYGS STMI: DO_DISOPRED3: ...............DDDDDDDDD DO_IUPRED2A: ........................ DO_SPOTD: ...............DDDDDDDDD CONSENSUS: ...............DDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[K]: KdlltmneelK