Q16514 TAF12_HUMAN

Gene name: TAF12
Protein name: Transcription initiation factor TFIID subunit 12

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96QE5 TEFM 0.66197 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
generation of precursor metabolites and energy GO:0006091
2 O75343 GUCY1B2 0.64699 signal transduction GO:0007165
3 Q7Z5U6 WDR53 0.59376
4 Q8N4W9 ZNF808 0.54808
5 O75113 N4BP1 0.54378 catabolic process GO:0009056
cellular protein modification process GO:0006464
6 B7Z8K6 TRDC 0.53191 immune system process GO:0002376
membrane organization GO:0061024
response to stress GO:0006950
...
7 Q8N7R0 NANOGP1 0.51331 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q4KWH8 PLCH1 0.50644 biosynthetic process GO:0009058
catabolic process GO:0009056
homeostatic process GO:0042592
...
9 Q9NZH5 PTTG2 0.49745 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
10 O60281 ZNF292 0.48906 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAAC
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
DO_IUPRED2A:             ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD..DDDDDDD...DDD....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
RICH_[FN]:                NqFgpsaliNlsNF                                                                                     
RICH_MOBI_[N]:            NqfgpsaliNlsN                                                                                      
RICH_MOBI_[FI]:             FgpsalInlsnFssI                                                                                  
RICH_MOBI_[FN]:           NqFgpsaliNlsNF                                                                                     

                                          120                 140                 160                   
AA:                      QLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
STMI:                                                                                 
DO_DISOPRED3:            ........................................................DD.DD
DO_IUPRED2A:             ............D.........................D..DD..........DDD.....
DO_SPOTD:                ..................................................DD.DDDDDDDD
CONSENSUS:               .....................................................DDDDDDDD
CONSENSUS_MOBI:          ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[K]:                                                  KKactteahKqrmalirKttKK
RICH_MOBI_[T]:                                                      TTeahkqrmalirkTT  
RICH_MOBI_[KT]:                                                 KKacTTeahKqrmalirKTTKK