Q16611 BAK_HUMAN

Gene name: BAK1
Protein name: Bcl-2 homologous antagonist/killer

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein maturation GO:0051604
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A4D126 CRPPA 0.89443 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q5SWW7 C10orf55 0.88492
3 Q5JXX5 n/a 0.86193
4 Q96PJ5 FCRL4 0.81068 immune system process GO:0002376
signal transduction GO:0007165
5 Q96DH6 MSI2 0.81031 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
6 Q96H96 COQ2 0.78633 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
7 O14734 ACOT8 0.76877 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q9UHF5 IL17B 0.76237 cell-cell signaling GO:0007267
immune system process GO:0002376
response to stress GO:0006950
9 P46089 GPR3 0.73225 cell cycle GO:0007049
homeostatic process GO:0042592
reproduction GO:0000003
...
10 Q14728 MFSD10 0.72542 cell death GO:0008219
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDD.....................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDD.................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDD.................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDD.................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDD...................................................................................
RICH_[GP]:                  GqGPGPPrqecGePalP                                                                                

                                          120                 140                 160                 180                 200
AA:                      QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL
STMI:                                                                                                           MMMMMMMMMMMMM
DO_DISOPRED3:            ..............................................................................................DDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               .......................................................................................             
CONSENSUS_MOBI:          ......................................................................................D             

                                  
AA:                      GQFVVRRFFKS
STMI:                    MMMMM      
DO_DISOPRED3:            DDDDDD.....
DO_IUPRED2A:             ...........
DO_SPOTD:                ...........
CONSENSUS:                    ......
CONSENSUS_MOBI:               ......