Q16611 BAK_HUMAN
Gene name: BAK1
Protein name: Bcl-2 homologous antagonist/killer
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein maturation GO:0051604
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A4D126 | CRPPA | 0.89443 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q5SWW7 | C10orf55 | 0.88492 | |
| 3 | Q5JXX5 | n/a | 0.86193 | |
| 4 | Q96PJ5 | FCRL4 | 0.81068 | immune system process GO:0002376 signal transduction GO:0007165 |
| 5 | Q96DH6 | MSI2 | 0.81031 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q96H96 | COQ2 | 0.78633 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 7 | O14734 | ACOT8 | 0.76877 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q9UHF5 | IL17B | 0.76237 | cell-cell signaling GO:0007267 immune system process GO:0002376 response to stress GO:0006950 |
| 9 | P46089 | GPR3 | 0.73225 | cell cycle GO:0007049 homeostatic process GO:0042592 reproduction GO:0000003 ... |
| 10 | Q14728 | MFSD10 | 0.72542 | cell death GO:0008219 transport GO:0006810 |
20 40 60 80 100 AA: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDD..................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDD................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDD................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDD................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD................................................................................... RICH_[GP]: GqGPGPPrqecGePalP
120 140 160 180 200 AA: QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL STMI: MMMMMMMMMMMMM DO_DISOPRED3: ..............................................................................................DDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ....................................................................................... CONSENSUS_MOBI: ......................................................................................D
AA: GQFVVRRFFKS STMI: MMMMM DO_DISOPRED3: DDDDDD..... DO_IUPRED2A: ........... DO_SPOTD: ........... CONSENSUS: ...... CONSENSUS_MOBI: ......