Q9UHF5 IL17B_HUMAN

Gene name: IL17B
Protein name: Interleukin-17B

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UPM9 B9D1 0.76237 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q9NZH0 GPRC5B 0.76237 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
3 Q1L6U9 MSMP 0.75112 immune system process GO:0002376
response to stress GO:0006950
4 Q92982 NINJ1 0.70278 anatomical structure development GO:0048856
cell adhesion GO:0007155
growth GO:0040007
5 A4D126 CRPPA 0.68188 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 Q2NL98 VMAC 0.67994
7 Q5VZI3 TMEM268 0.67472
8 Q5SWW7 C10orf55 0.67463
9 Q5JXX5 n/a 0.65711
10 P0DPD6 ECE2 0.6546 cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604

                                           20                  40                  60                  80                 100
AA:                      MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSP
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.............................DDDDDDDDDDDDDDDDDD..............
DO_IUPRED2A:             .......................DDDDDDDDDDDDDDDDDDDDDD...........................D...........................
DO_SPOTD:                DDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DD...........D...D..DD..DDDDDDDDDDDD................
CONSENSUS:                                   DDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDD................
CONSENSUS_MOBI:                              .DDDDDDDDDDDDDDDDDDDDDDD........................................................
RICH_[GP]:                                    PrsPkskrkGqGrPGPlaPGP                                                          
RICH_MOBI_[GP]:                                          GrPGPlaPGP                                                          

                                          120                 140                 160
AA:                      WGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
STMI:                                                                                                    
DO_DISOPRED3:            ................................................................................
DO_IUPRED2A:             ................................................................D...............
DO_SPOTD:                ................................................................................
CONSENSUS:               ................................................................................
CONSENSUS_MOBI:          ................................................................................