Q16612 NREP_HUMAN

Gene name: NREP
Protein name: Neuronal regeneration-related protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0AVF1 TTC26 0.89261 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q96P63 SERPINB12 0.89261 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
3 A0A1B0GVM5 ETDC 0.89239
4 Q3ZM63 ETDA 0.89225
5 Q6ZNX1 SHLD3 0.8921 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
6 Q5JX71 FAM209A 0.89195
7 Q8WV22 NSMCE1 0.8916 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
...
8 O95057 DIRAS1 0.8916 signal transduction GO:0007165
9 Q9HAN9 NMNAT1 0.88168 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
10 Q4W5G0 TIGD2 0.87571

                                           20                  40                  60            
AA:                      MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
STMI:                                                                                        
DO_DISOPRED3:            ....................................................................
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
DO_SPOTD:                DDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
RICH_[K]:                                          KgrlpvpKevnrKK                            
RICH_MOBI_[K]:                                     KgrlpvpKevnrKK                            
RICH_MOBI_[NV]:                                         VpkeVNrkkN