Q494R0 FBAS1_HUMAN
Gene name: FBXL19-AS1
Protein name: Putative uncharacterized protein FBXL19-AS1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17152 | TMEM11 | 0.6492 | membrane organization GO:0061024 |
| 2 | Q86V71 | ZNF429 | 0.62023 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | P38936 | CDKN1A | 0.61475 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 4 | Q8WXH2 | JPH3 | 0.60829 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 nervous system process GO:0050877 ... |
| 5 | Q8TEC5 | SH3RF2 | 0.60105 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 6 | Q8TER5 | ARHGEF40 | 0.60047 | |
| 7 | P28062 | PSMB8 | 0.59539 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | O95922 | TTLL1 | 0.59434 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 9 | Q8N8I6 | LINC00482 | 0.59181 | |
| 10 | A6NKC9 | SH2D7 | 0.58963 |
20 40 60 80 100 AA: MAEPGGRGDYRKDGRLPSLSRSPLSTTLGTSPACGLEIPPTSGARPDGSCSLPAPVYHLKSRQWKGMGRGYRQRWRLQGRGDCDMGCVVQASGLFPAEMR STMI: DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD.D..DDDD.DDDDDDD...DDDDD......................D.........................DDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................... RICH_[PT]: PlsTTlgTsPacgleiPPT RICH_[G]: GGrGdyrkdG RICH_[R]: RgdyRkdgRlpslsR RICH_[T]: TTlgTspacgleippT RICH_[GR]: GGRGdyRkdGRlpslsR RICH_[LS]: LpSLSrSpLS RICH_MOBI_[G]: GGrGdyrkdG RICH_MOBI_[L]: LpsLsrspLsttLgtspacgL RICH_MOBI_[R]: RgdyRkdgRlpslsR RICH_MOBI_[T]: TTlgTspacgleippT RICH_MOBI_[GR]: GGRGdyRkdGRlpslsR RICH_MOBI_[LS]: LpSLSrSpLSttLgtS
120 AA: ERTTKKMATSPLDLCAGACWEM STMI: DO_DISOPRED3: ...................... DO_IUPRED2A: DDDD.D................ DO_SPOTD: ...................... CONSENSUS: ...................... CONSENSUS_MOBI: ......................