Q9NRR3 C42S2_HUMAN

Gene name: CDC42SE2
Protein name: CDC42 small effector protein 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5JQF7 LINC01556 0.9113
2 Q14197 MRPL58 0.71468 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q9Y2E5 MAN2B2 0.70711 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
4 Q96HU1 SGSM3 0.70711 catabolic process GO:0009056
cell cycle GO:0007049
protein transport GO:0015031
...
5 Q6T310 RASL11A 0.66095 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
signal transduction GO:0007165
6 P26373 RPL13 0.59421 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q6ZVN7 SEM1 0.55454 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
8 O60762 DPM1 0.55216 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
9 Q70J99 UNC13D 0.5512 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
10 Q9H7R5 ZNF665 0.54677 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                
AA:                      MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
STMI:                                                                                                        
DO_DISOPRED3:            D.................................................................................DD
DO_IUPRED2A:             ..................DDDDDDDDDDDD....D......................DD.DDDDDDDD........D.......
DO_SPOTD:                DDDD........DDDDDDDDDDDDDDDDDDDDDD.........DDDDDDD.D........DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D.................DDDDDDDDDDDD..............................DDDDDDDD........D.....DD
CONSENSUS_MOBI:          ....................................................................................
RICH_[IR]:                                  RRRRIdRsmI                                                       
RICH_fLPS_[R]:                             kRRRRidRsm