List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell morphogenesis GO:0000902
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q5JQF7	LINC01556	0.9113
2	Q14197	MRPL58	0.71468	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
3	Q9Y2E5	MAN2B2	0.70711	carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular protein modification process GO:0006464 ...
4	Q96HU1	SGSM3	0.70711	catabolic process GO:0009056 cell cycle GO:0007049 protein transport GO:0015031 ...
5	Q6T310	RASL11A	0.66095	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165
6	P26373	RPL13	0.59421	anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ...
7	Q6ZVN7	SEM1	0.55454	cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ...
8	O60762	DPM1	0.55216	biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281
9	Q70J99	UNC13D	0.5512	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ...
10	Q9H7R5	ZNF665	0.54677	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                
AA:                      MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
STMI:                                                                                                        
DO_DISOPRED3:            D.................................................................................DD
DO_IUPRED2A:             ..................DDDDDDDDDDDD....D......................DD.DDDDDDDD........D.......
DO_SPOTD:                DDDD........DDDDDDDDDDDDDDDDDDDDDD.........DDDDDDD.D........DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D.................DDDDDDDDDDDD..............................DDDDDDDD........D.....DD
CONSENSUS_MOBI:          ....................................................................................
RICH_[IR]:                                  RRRRIdRsmI                                                       
RICH_fLPS_[R]:                             kRRRRidRsm