Q5SXM8 DNLZ_HUMAN

Gene name: DNLZ
Protein name: DNL-type zinc finger protein

List of terms from Generic GO subset, which this protein is a part of:
- protein folding GO:0006457
- protein targeting GO:0006605
- protein transport GO:0015031
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q01581 HMGCS1 0.86368 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
2 P0DKB6 MPC1L 0.81682 transmembrane transport GO:0055085
transport GO:0006810
3 P0DKB5 TPBGL 0.81083
4 Q14896 MYBPC3 0.7962 anatomical structure development GO:0048856
cell adhesion GO:0007155
circulatory system process GO:0003013
...
5 Q8N8R3 SLC25A29 0.79286 transmembrane transport GO:0055085
transport GO:0006810
6 P51817 PRKX 0.79044 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
7 Q96I15 SCLY 0.78053 small molecule metabolic process GO:0044281
8 P57086 SCAND1 0.7487
9 Q9UFC0 LRWD1 0.74677 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
10 P10415 BCL2 0.74275 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTC
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
DO_IUPRED2A:             ......................................................DDDD.D........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
CONSENSUS:                                                                DDDDDDDDDDDDDD.....................................
CONSENSUS_MOBI:                                                           ...................................................

                                          120                 140                 160  
AA:                      PGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS
STMI:                                                                                                  
DO_DISOPRED3:            ......................................................DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........................DD...DD..D..............DD..DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ..........................................DD.......DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                                                                  AgAPtstAAPeAgedegPPsP      
RICH_[A]:                                                                   AgAptstAApeA               
RICH_[EP]:                                                                           PEagEdEgPPsPgktEP 
RICH_MOBI_[A]:                                                             AAgAptstAApeA               
RICH_fLPS_MOBI_[A]:                                                        AAgAptstAApeAge