Q5SY13 COAS1_HUMAN

Gene name: COL5A1-AS1
Protein name: Putative uncharacterized protein encoded by COL5A1-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P18054 ALOX12 0.70711
2 O60256 PRPSAP2 0.52145 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
3 Q15121 PEA15 0.48864 cell cycle GO:0007049
cell death GO:0008219
cellular protein modification process GO:0006464
...
4 Q9NNX1 TUFT1 0.46667 anatomical structure development GO:0048856
signal transduction GO:0007165
5 P36406 TRIM23 0.45458 biological process involved in symbiotic interaction GO:0044403
cellular protein modification process GO:0006464
immune system process GO:0002376
...
6 P56555 DSCR4 0.42339
7 Q9GZS1 POLR1E 0.41026 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
8 P08F94 PKHD1 0.40448 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
9 P43686 PSMC4 0.39076 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q9BYC5 FUT8 0.38294 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...

                                           20                  40    
AA:                      MRRPWEKKEATRNPIAEVLARKKRTEELISLQEHGSRKQKIKEASISWAETSRQIG
STMI:                                                                            
DO_DISOPRED3:            DD.....................................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDD..DDDDDDDDD........
DO_SPOTD:                DDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDD.......D
CONSENSUS_MOBI:          .............................DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[I]:                                                   IkeasIswaetsrqI