Q5SY85 F201A_HUMAN

Gene name: FAM201A
Protein name: Protein FAM201A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5VZF2 MBNL2 0.72614 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
2 Q9Y2U2 KCNK7 0.70444 transmembrane transport GO:0055085
transport GO:0006810
3 Q9Y6X3 MAU2 0.68889 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
4 Q9NR56 MBNL1 0.66208 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
5 A6NHC0 CAPN8 0.6564
6 Q9BX46 RBM24 0.65115 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q9NQX7 ITM2C 0.63652 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
8 Q7RTV5 PRXL2C 0.63153 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9Y6M1 IGF2BP2 0.62179 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q9Y508 RNF114 0.61859 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MGLRAGSRCRADHLAQPQPQGHLAPVLRCGECWRARGLPGGCCLHTEGGCSLGAQAGWRTAGWEARGRRDLGLETTSAHSRSLLHLSSWRRPDVGEAAGA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD..................................................................................
DO_IUPRED2A:             .........DDD.DDD...DD.............................................D.DDDDDDD........DDD..........D.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD..DDDDDDDDDDDDDDDDDDD........DDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDD.....................DDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AQ]:                                                                                                               AAgA
RICH_[A]:                                                                                                                AAgA
RICH_fLPS_[A]:                                                                                                           AAgA

                                          120                 140     
AA:                      ELLQRAPLQQPDPAQAAVEGGLLARLPRPQDQGCGQHRPHSPRLVDIALPGGGWT
STMI:                                                                           
DO_DISOPRED3:            .......................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDD.DDDDD......
DO_SPOTD:                DDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS_MOBI:          .............................DDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AL]:                      LqqpdpAqAAveggLLArL                             
RICH_[AP]:                         PdPAqAAveggllArlPrP                          
RICH_[AQ]:               ellQrAplQQpdpAQAA                                      
RICH_[A]:                ellqrAplqqpdpAqAA                                      
RICH_[Q]:                   QraplQQpdpaQ                                        
RICH_[HQ]:                                            QdQgcgQHrpH               
RICH_fLPS_[A]:           ellqrAplqqpdpAqAA                                      
RICH_MOBI_[HQ]:                                       QdQgcgQHrpH