Q9Y508 RN114_HUMAN
Gene name: RNF114
Protein name: E3 ubiquitin-protein ligase RNF114
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y584 | TIMM22 | 0.90113 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 2 | Q96H72 | SLC39A13 | 0.89969 | anatomical structure development GO:0048856 homeostatic process GO:0042592 transmembrane transport GO:0055085 ... |
| 3 | P86791 | CCZ1 | 0.87556 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | Q96CN7 | ISOC1 | 0.8746 | |
| 5 | P07902 | GALT | 0.87017 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9Y6X3 | MAU2 | 0.86419 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 7 | Q9NUP9 | LIN7C | 0.85436 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 8 | Q96MZ0 | GDAP1L1 | 0.85436 | |
| 9 | Q9NVX2 | NLE1 | 0.85436 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 10 | P0DMW5 | SMIM10L2B | 0.85408 |
20 40 60 80 100 AA: MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAVELERQIESTETSCHGCRKNFFL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GGAAqlAGpA RICH_[AQ]: AAQQrdcggAAQlA RICH_[A]: AAqqrdcggAAqlAgpAAeA RICH_fLPS_[A]: AAqqrdcggAAqlAgpAAeA
120 140 160 180 200 AA: SKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .........................DDDDDDDDDDDDD.............................................................. CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: FSYDTFVDYDVDEEDMMNQVLQRSIIDQ STMI: DO_DISOPRED3: ...........................D DO_IUPRED2A: .....................D...... DO_SPOTD: .......................DDDDD CONSENSUS: ...........................D CONSENSUS_MOBI: ............................