Q5T752 LCE1D_HUMAN

Gene name: LCE1D
Protein name: Late cornified envelope protein 1D

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T753 LCE1E 0.84188 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q5T754 LCE1F 0.83378 anatomical structure development GO:0048856
cell differentiation GO:0030154
3 Q5TCM9 LCE5A 0.8288 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 Q5T7P2 LCE1A 0.7977 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
5 Q5T751 LCE1C 0.78881 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T7P3 LCE1B 0.75319 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 O14633 LCE2B 0.71724 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q5T5B0 LCE3E 0.70386 anatomical structure development GO:0048856
cell differentiation GO:0030154
9 Q5TA76 LCE3A 0.69796 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
10 Q5TA81 LCE2C 0.68479 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80                 100
AA:                      MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCGSNSGGCCSSGGGGCCLSHHRRHRSHRRRPQSSDCCSQPSGGSS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...D.......DDDDDDD................DDDDDDD............D.
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDD................DDDDDDD............DD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD.....................................................DDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQsQQQcQPPPkctPkctPkcP                                                                           
RICH_[C]:                  CqqsqqqCqpppkCtpkCtpkCpapkCppkCppvssCCsvssggCC                                                    
RICH_[K]:                              KctpKctpKcpapKcppK                                                                    
RICH_[P]:                           PPPkctPkctPkcPaPkcPPkcPP                                                                 
RICH_[CG]:                                                      CsvssGGCCG                                                   
RICH_[CK]:                        CqpppKCtpKCtpKCpapKCppKC                                                                   
RICH_[CP]:                 CqqsqqqCqPPPkCtPkCtPkCPaPkCPPkCPPvssCCsvssggCC                                                    
RICH_[CQ]:                 CQQsQQQCQpppkCtpkCtpkC                                                                            
RICH_[CS]:                                               CppvSSCCSvSSggCC                                                  SS
RICH_[GS]:                                                                                                                 SS
RICH_[KP]:                          PPPKctPKctPKcPaPKcPPKcPP                                                                 
RICH_fLPS_[P]:                                   PaPkcPPkcPP                                                                 
RICH_fLPS_[Q]:            scQQsQQQcQ                                                                                         
RICH_fLPS_[C]:                    CqpppkCtpkCtpkCpapkC   CppvssCCsvssggCC                                                   s
RICH_fLPS_[CQ]:            CQQsQQQCQpppkCtpkCtpkC                                                                            
RICH_MOBI_[RS]:                                                                                         RShRRRpqSSdccSqpSggS 
RICH_MOBI_[C]:             CqqsqqqCqpppkCtpkC                                                                      CCsqpsggss
RICH_MOBI_[G]:                                                                                                           GGss
RICH_MOBI_[S]:                                                                                                  SSdccSqpSggSS
RICH_MOBI_[CG]:                                                                                                    CCsqpsGGss
RICH_MOBI_[CH]:                                                                                    HHrrHrsHrrrpqssdCC        
RICH_MOBI_[CP]:                   CqPPPkCtPkC                                                                                
RICH_MOBI_[CQ]:            CQQsQQQCQpppkCtpkC                                                                                
RICH_MOBI_[CR]:                                                                                      RRhRshRRRpqssdCC        
RICH_MOBI_[CS]:                                                                                          ShrrrpqSSdCCSqpSggSS
RICH_MOBI_[GS]:                                                                                                 SSdccSqpSGGSS
RICH_MOBI_[HR]:                                                                                    HHRRHRsHRRR               
RICH_fLPS_MOBI_[Q]:      mscQQsQQQcQpppkctpkc                                                                                
RICH_fLPS_MOBI_[QC]:     msCQQsQQQCQpppkCtpkC                                                                                
RICH_fLPS_MOBI_[C]:      msCqqsqqqCqpppkCtpkC                                                                                
RICH_fLPS_MOBI_[CQ]:     msCQQsQQQCQpppkCtpkC                                                                                

                               
AA:                      CCGGGSSQHSGGCC
STMI:                                  
DO_DISOPRED3:            .DDDDDDDDDDDDD
DO_IUPRED2A:             ..............
DO_SPOTD:                DDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDD
RICH_[C]:                CCgggssqhsggCC
RICH_[G]:                  GGGssqhsGG  
RICH_[CG]:               CCGGGssqhsGGCC
RICH_[CS]:               CCgggSSqhSggCC
RICH_[GS]:               ccGGGSSqhSGG  
RICH_fLPS_[C]:           CCgggssqhsggCC
RICH_MOBI_[C]:           CCgggssqhsggCC
RICH_MOBI_[G]:           ccGGGssqhsGG  
RICH_MOBI_[S]:           ccgggSS       
RICH_MOBI_[CG]:          CCGGGssqhsGGCC
RICH_MOBI_[CS]:          CCgggSSqhSggCC
RICH_MOBI_[GS]:          ccGGGSSqhSGG