Q5T5B0 LCE3E_HUMAN

Gene name: LCE3E
Protein name: Late cornified envelope protein 3E

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BYE3 LCE3D 0.86595 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
2 Q5T5A8 LCE3C 0.85625 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
3 Q5T751 LCE1C 0.75723 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 Q5TA77 LCE3B 0.7342 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
5 Q5T753 LCE1E 0.70889 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T752 LCE1D 0.70386 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
7 O14633 LCE2B 0.70005 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q5T7P2 LCE1A 0.68126 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
9 Q5T754 LCE1F 0.67721 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 A0A1B0GTR4 SPRR5 0.66118

                                           20                  40                  60                  80        
AA:                      MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC
STMI:                                                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD.....................................DD.DDDDDD.DDDDDDDDDDDDDDDDDD...D
DO_IUPRED2A:             ............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDD.........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQnQkQcQPPPkcPsPkcPP                                                                     
RICH_[C]:                  CqqnqkqCqpppkCpspkC                                                 CdrgsgqqgggsgCC       
RICH_[G]:                                                                                         GsGqqGGGsGcchGsGG  
RICH_[P]:                           PPPkcPsPkcPP                                                                     
RICH_[R]:                                                                             RcRRqRsnscdR                   
RICH_[CG]:                                                                             CrrqrsnsCdrGsGqqGGGsGCChGsGGCC
RICH_[CP]:                 CqqnqkqCqPPPkCPsPkCPP                                                                     
RICH_[CQ]:                 CQQnQkQCQpppkCpspkC                                                                       
RICH_[CR]:                                                                            RCRRqRsnsCdR                   
RICH_[GR]:                                                                            RcRRqRsnscdRGsGqqGGGsG         
RICH_fLPS_[Q]:           mscQQnQkQcQpppk                                                                             
RICH_fLPS_[C]:            sCqqnqkqCqpppkCpspkC                                                                       
RICH_fLPS_[CQ]:          msCQQnQkQCQpppkCpspkC                                                                       
RICH_MOBI_[PQ]:             QQnQkQcQPPPkcPsPkcP                                                                      
RICH_MOBI_[C]:             CqqnqkqCqpppkCpspkC                                                 CdrgsgqqgggsgCChgsggCC
RICH_MOBI_[G]:                                                                                    GsGqqGGGsGcchGsGG  
RICH_MOBI_[P]:                      PPPkcPsPkcP                                                                      
RICH_MOBI_[R]:                                                                          RRqRsnscdR                   
RICH_MOBI_[CG]:                                                                                CdrGsGqqGGGsGCChGsGGCC
RICH_MOBI_[CP]:            CqqnqkqCqPPPkCPsPkCP                                                                      
RICH_MOBI_[CQ]:            CQQnQkQCQpppkCpspkC                                                                       
RICH_MOBI_[GR]:                                                                         RRqRsnscdRGsGqqGGGsG         
RICH_fLPS_MOBI_[Q]:      mscQQnQkQcQpppk                                                                             
RICH_fLPS_MOBI_[C]:       sCqqnqkqCqpppkCpspkC                                                                       
RICH_fLPS_MOBI_[CQ]:     msCQQnQkQCQpppkCpspkC